PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A07G2287
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family Trihelix
Protein Properties Length: 847aa    MW: 94834.2 Da    PI: 7.4824
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A07G2287genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix27.77.1e-092202802081
     trihelix  20 rlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpy 81 
                  ++ rgk ++ + +ev++++ ++g++r +k+   kw+n+ ++++k+ e+e++++ e++   +y
  Gh_A07G2287 220 QSTRGKTRADKDREVAEFLNKHGINRDAKTAGTKWDNMLGEFRKVYEWERGGEREQV-GKSY 280
                  567889999999**************************************9965555.3445 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF561125.94E-16684838IPR011009Protein kinase-like domain
CDDcd001806.39E-12698835No hitNo description
Gene3DG3DSA:1.10.510.108.5E-6700798No hitNo description
Sequence ? help Back to Top
Protein Sequence    Length: 847 aa     Download sequence    Send to blast
MGGNKGDATK KQTPQPTQQL SSSPKEPLEE SSESRQKHLQ QPSAVVVTAT GPPFISAPLY  60
VPTGATSSPF EQQFESVNPK RSRYNSGQWK LLPSSSYLQS QAQMAIITSE SSPSPTNPIN  120
PQTQAQTTAA SSSDAASSPP HSPLPSTTSG QETNKPEDQQ FHHQFRKGKY VSPVWKPNEM  180
LWLARAWRIQ YQGGSDASGS SSRSGHQEIG PFTGSDLAVQ STRGKTRADK DREVAEFLNK  240
HGINRDAKTA GTKWDNMLGE FRKVYEWERG GEREQVGKSY FRLSPYERKL HRLPASFDEE  300
VFEELSQFMG PRMRTSQSRG ASAIASSDDG RSVLSGPRPL PPAPPFKVDE LPLSGFTERA  360
QLPFAEPSIR SVPPLELQDP TDYYIGCLRV PPTVLPGLFE LSWHLQEPLP EEYRFPLRKD  420
VYRDLPAGKE VLFTTTSELL DCRAMVYDVL SSIIRTNPSL SAATATSRDS FIGLWDDCVN  480
RVISKFCSVE MVIIRKPSSS STEPLQDQWP NVTGFVRNFC LWRGEETDQV REGHPDPSSS  540
LVEKLLWTYM DLPYVLGYYA VGYMVTFCAL SRSQDRILRT DLYSVDLSSP SERLKALVPC  600
CRIAGLLPLL ADRCFNTISN VGSYKQFPFS DFERINLRNG SIMEMTPNTV TRSFSNKKKW  660
AAVKEIYDIL DHRIPHSELI CRACEKDLVL VFKPRGCKFK PINCEQLVEA LKYVTKALVA  720
LHDLCFMHRD LGWDKVLRRS DTENEWFVCG FDEAVGAPQI YPHPVAGTDT DARGRHAPEM  780
GRGLHGVKVD VWGVGYLVKT CGLTNVPKML RELETRCLDQ NPEQRPTAAD CYHHLLQVQS  840
ASSGAPY
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012465877.10.0PREDICTED: uncharacterized protein LOC105784438 isoform X2
TrEMBLA0A0D2QKQ50.0A0A0D2QKQ5_G
STRINGVIT_16s0022g02290.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM83561624
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33550.16e-07Trihelix family protein